Lineage for d1wgwa_ (1wgw A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765693Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 765694Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 765695Protein Signal recognition particle 54 kDa protein, SRP54 [116874] (1 species)
  7. 765696Species Mouse (Mus musculus) [TaxId:10090] [116875] (1 PDB entry)
    Uniprot P14576 4-85
  8. 765697Domain d1wgwa_: 1wgw A: [114625]
    Structural genomics target

Details for d1wgwa_

PDB Entry: 1wgw (more details)

PDB Description: solution structure of the n-terminal domain of mouse putative signal recognition particle 54 (srp54)
PDB Compounds: (A:) 'Signal Recoginition Particle 54

SCOP Domain Sequences for d1wgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgadlgrkitsalrslsnatiineevlnamlkevctalleadvniklvkqlrenv
ksaidleemasglnkrkmiqhavfkelvkvkvysgpssg

SCOP Domain Coordinates for d1wgwa_:

Click to download the PDB-style file with coordinates for d1wgwa_.
(The format of our PDB-style files is described here.)

Timeline for d1wgwa_: