| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) ![]() |
| Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
| Protein Signal recognition particle 54 kDa protein, SRP54 [116874] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [116875] (1 PDB entry) Uniprot P14576 4-85 |
| Domain d1wgwa_: 1wgw A: [114625] Structural genomics target |
PDB Entry: 1wgw (more details)
SCOP Domain Sequences for d1wgwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgadlgrkitsalrslsnatiineevlnamlkevctalleadvniklvkqlrenv
ksaidleemasglnkrkmiqhavfkelvkvkvysgpssg
Timeline for d1wgwa_: