Lineage for d1wcv1_ (1wcv 1:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2481044Species Thermus thermophilus [TaxId:262724] [187453] (15 PDB entries)
  8. 2481056Domain d1wcv1_: 1wcv 1: [161948]
    automated match to d1hyqa_
    complexed with cl, iod

Details for d1wcv1_

PDB Entry: 1wcv (more details), 1.6 Å

PDB Description: structure of the bacterial chromosome segregation protein soj
PDB Compounds: (1:) segregation protein

SCOPe Domain Sequences for d1wcv1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcv1_ c.37.1.0 (1:) automated matches {Thermus thermophilus [TaxId: 262724]}
kvrrialanqkggvgktttainlaaylarlgkrvllvdldpqgnatsglgvraergvyhl
lqgepleglvhpvdgfhllpatpdlvgatvelagaptalrealrdegydlvlldappsls
pltlnalaaaegvvvpvqaeyyalegvagllatleevraglnprlrllgilvtmydgrtl
laqqveaqlrahfgekvfwtviprnvrlaeapsfgktiaqhaptspgahayrrlaeevma
rvqe

SCOPe Domain Coordinates for d1wcv1_:

Click to download the PDB-style file with coordinates for d1wcv1_.
(The format of our PDB-style files is described here.)

Timeline for d1wcv1_: