Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
Protein Adenylate cyclase CyaC [117982] (1 species) |
Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries) Uniprot O32393 1004-1200 |
Domain d1wc1a_: 1wc1 A: [114492] complexed with mg, tat |
PDB Entry: 1wc1 (more details), 1.93 Å
SCOPe Domain Sequences for d1wc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wc1a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]} lrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqg mavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflel kgidepvmtcvinpnml
Timeline for d1wc1a_: