Lineage for d1wbfa_ (1wbf A:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.1: Legume lectins [49900] (5 proteins) 
Protein Legume lectin [49904] (23 species) 
Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries) 
Domain d1wbfa_: 1wbf A: [24050]
complexed with ca, mn, nag
Details for d1wbfa_
PDB Entry: 1wbf (more details), 2.3 Å
PDB Description: winged bean lectin, saccharide free form
PDB Compounds: (A:) protein (agglutinin)SCOPe Domain Sequences for d1wbfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbfa_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
SCOPe Domain Coordinates for d1wbfa_:
Click to download the PDB-style file with coordinates for d1wbfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wbfa_:
- d1wbfa_ first appeared (with stable ids) in SCOP 1.55
- d1wbfa_ appears in SCOPe 2.01
- d1wbfa_ appears in SCOPe 2.03
- d1wbfa_ appears in the current release, SCOPe 2.08
View in 3D
