Lineage for d1w62a_ (1w62 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546724Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2546725Protein automated matches [190491] (18 species)
    not a true protein
  7. 2546812Species Trypanosoma cruzi [TaxId:5693] [267764] (5 PDB entries)
  8. 2546817Domain d1w62a_: 1w62 A: [264193]
    automated match to d4q2ha_
    complexed with pyc

Details for d1w62a_

PDB Entry: 1w62 (more details), 2.5 Å

PDB Description: proline racemase in complex with one molecule of pyrrole-2-carboxylic acid (hemi form)
PDB Compounds: (A:) b-cell mitogen

SCOPe Domain Sequences for d1w62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w62a_ d.21.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
hqqkreimrfkksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgim
leprghddmfgaflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpak
atnvpvvldtpaglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvd
iafggnffaivpaeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcve
iygpptnpeanyknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgsl
fqgrvlgeeripgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlk
qy

SCOPe Domain Coordinates for d1w62a_:

Click to download the PDB-style file with coordinates for d1w62a_.
(The format of our PDB-style files is described here.)

Timeline for d1w62a_: