SCOPe 2.08: Domain d1vywb1: 1vyw B:175-309

Lineage for d1vywb1 (1vyw B:175-309)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the others
Superfamily a.74.1: Cyclin-like [47954] (4 families)
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (9 proteins)
Protein Cyclin A [47956] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
Uniprot P20248 175-432
Domain d1vywb1: 1vyw B:175-309 [108923]
Other proteins in same PDB: d1vywa1, d1vywa2, d1vywc1, d1vywc2
complexed with 292, so4

Details for d1vywb1

PDB Entry: 1vyw (more details), 2.3 Å

PDB Description: structure of cdk2/cyclin a with pnu-292137

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1vywb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vywb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d1vywb1:

Click to download the PDB-style file with coordinates for d1vywb1.
(The format of our PDB-style files is described here.)

Timeline for d1vywb1: