Lineage for d1vp2a_ (1vp2 A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the restSuperfamily c.51.4: ITPase-like [52972] (4 families) 
formerly Maf/Ham1; elaborated with additional structures inserted in the common foldFamily c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
Pfam PF01725
Protein Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 [117615] (1 species) Species Thermotoga maritima [TaxId:2336] [117616] (2 PDB entries)
Uniprot Q9WY06
Domain d1vp2a_: 1vp2 A: [113933]
Structural genomics target
complexed with so4
Details for d1vp2a_
PDB Entry: 1vp2 (more details), 1.78 Å
PDB Description: crystal structure of a putative xanthosine triphosphate pyrophosphatase/ham1 protein homolog (tm0159) from thermotoga maritima at 1.78 a resolution
PDB Compounds: (A:) Putative Xanthosine triphosphate pyrophosphatase/HAM1 protein homologSCOPe Domain Sequences for d1vp2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp2a_ c.51.4.1 (A:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]}
kltvylattnphkveeikmiapewmeilpspekievvedgetflensvkkavvygkklkh
pvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkdrraafvcsatffdp
ventlisvedrvegrianeirgtggfgydpffipdgydktfgeiphlkekishrskafrk
lfsvlekil
SCOPe Domain Coordinates for d1vp2a_:
Click to download the PDB-style file with coordinates for d1vp2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vp2a_:
- d1vp2a_ first appeared in SCOP 1.71
- d1vp2a_ appears in SCOPe 2.06
- d1vp2a_ appears in the current release, SCOPe 2.08
View in 3D
