Lineage for d1vloa1 (1vlo A:278-367)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
barrel, closed; n=6, S=10; greek-keySuperfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) 
Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) 
Protein Glycine cleavage system T protein, GcvT [110231] (4 species) 
Species Escherichia coli [TaxId:562] [110233] (1 PDB entry)
Uniprot P27248
Domain d1vloa1: 1vlo A:278-367 [108838]
Other proteins in same PDB: d1vloa2
Structural genomics target
Details for d1vloa1
PDB Entry: 1vlo (more details), 1.7 Å
PDB Description: Crystal structure of aminomethyltransferase (T protein; tetrahydrofolate-dependent) of glycine cleavage system (np417381) from Escherichia coli k12 at 1.70 A resolution
PDB Compounds: (A:) AminomethyltransferaseSCOPe Domain Sequences for d1vloa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vloa1 b.44.2.1 (A:278-367) Glycine cleavage system T protein, GcvT {Escherichia coli [TaxId: 562]}
teklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegiget
aivqirnrempvkvtkpvfvrngkavaglc
SCOPe Domain Coordinates for d1vloa1:
Click to download the PDB-style file with coordinates for d1vloa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vloa1:
- d1vloa1 first appeared in SCOP 1.69
- d1vloa1 appears in SCOPe 2.04
- d1vloa1 appears in SCOPe 2.06
- d1vloa1 appears in the current release, SCOPe 2.08
View in 3D
