Lineage for d1vloa1 (1vlo A:268-367)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464914Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464975Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) (S)
  5. 464976Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 464977Protein Glycine cleavage system T protein, GcvT [110231] (2 species)
  7. 464978Species Escherichia coli [TaxId:562] [110233] (1 PDB entry)
  8. 464979Domain d1vloa1: 1vlo A:268-367 [108838]
    Other proteins in same PDB: d1vloa2
    Structural genomics target

Details for d1vloa1

PDB Entry: 1vlo (more details), 1.7 Å

PDB Description: Crystal structure of aminomethyltransferase (T protein; tetrahydrofolate-dependent) of glycine cleavage system (np417381) from Escherichia coli k12 at 1.70 A resolution

SCOP Domain Sequences for d1vloa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vloa1 b.44.2.1 (A:268-367) Glycine cleavage system T protein, GcvT {Escherichia coli}
ealevqrehgteklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysial
arvpegigetaivqirnrempvkvtkpvfvrngkavaglc

SCOP Domain Coordinates for d1vloa1:

Click to download the PDB-style file with coordinates for d1vloa1.
(The format of our PDB-style files is described here.)

Timeline for d1vloa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vloa2