Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) |
Family d.61.1.0: automated matches [191492] (1 protein) not a true family |
Protein automated matches [190796] (6 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [188054] (2 PDB entries) |
Domain d1vgja_: 1vgj A: [161856] automated match to d1iuha_ |
PDB Entry: 1vgj (more details), 1.94 Å
SCOPe Domain Sequences for d1vgja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgja_ d.61.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} mrafiaidvnesvrdslvraqdyigskeakikfverenlhitlkflgeiteeqaeeikni lkkiaekykkhevkvkgigvfpnpnyirviwagiendeiiremareiedelaklgfkkeg nfvahitlgrvkfvkdklgltmklkelanedfgsfvvdaielkkstltpkgpiyetlarf else
Timeline for d1vgja_: