Lineage for d1vgja_ (1vgj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956563Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2956564Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2956626Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2956627Protein automated matches [190796] (6 species)
    not a true protein
  7. 2956661Species Pyrococcus horikoshii [TaxId:53953] [188054] (2 PDB entries)
  8. 2956662Domain d1vgja_: 1vgj A: [161856]
    automated match to d1iuha_

Details for d1vgja_

PDB Entry: 1vgj (more details), 1.94 Å

PDB Description: Crystal structure of 2'-5' RNA ligase from Pyrococcus horikoshii
PDB Compounds: (A:) Hypothetical protein PH0099

SCOPe Domain Sequences for d1vgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgja_ d.61.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mrafiaidvnesvrdslvraqdyigskeakikfverenlhitlkflgeiteeqaeeikni
lkkiaekykkhevkvkgigvfpnpnyirviwagiendeiiremareiedelaklgfkkeg
nfvahitlgrvkfvkdklgltmklkelanedfgsfvvdaielkkstltpkgpiyetlarf
else

SCOPe Domain Coordinates for d1vgja_:

Click to download the PDB-style file with coordinates for d1vgja_.
(The format of our PDB-style files is described here.)

Timeline for d1vgja_: