Lineage for d1vfra_ (1vfr A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) 
Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) 
Protein Flavin reductase P (NADPH:FMN oxidoreductase) [55473] (2 species) 
Species Vibrio fischeri [TaxId:668] [55475] (3 PDB entries) 
Domain d1vfra_: 1vfr A: [40247]
complexed with fmn
Details for d1vfra_
PDB Entry: 1vfr (more details), 1.8 Å
PDB Description: the major nad(p)h:fmn oxidoreductase from vibrio fischeri
PDB Compounds: (A:) nad(p)h:fmn oxidoreductaseSCOPe Domain Sequences for d1vfra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfra_ d.90.1.1 (A:) Flavin reductase P (NADPH:FMN oxidoreductase) {Vibrio fischeri [TaxId: 668]}
thpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakqr
mhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafas
fkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadelk
gyechvalaigyhhpsedynaslpksrkafedvitil
SCOPe Domain Coordinates for d1vfra_:
Click to download the PDB-style file with coordinates for d1vfra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vfra_:
- d1vfra_ first appeared (with stable ids) in SCOP 1.55
- d1vfra_ appears in SCOPe 2.05
- d1vfra_ appears in SCOPe 2.07
- d1vfra_ appears in the current release, SCOPe 2.08
View in 3D
