Lineage for d1veka_ (1vek A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763614Family a.5.2.1: UBA domain [46935] (24 proteins)
  6. 763709Protein Ubiquitin isopeptidase T [116826] (1 species)
  7. 763710Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116827] (2 PDB entries)
    Uniprot Q9LJT6 594-665; Q8L6Y1 651-710
  8. 763711Domain d1veka_: 1vek A: [113636]
    Structural genomics target

Details for d1veka_

PDB Entry: 1vek (more details)

PDB Description: solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna
PDB Compounds: (A:) ubiquitin-specific protease 14, putative

SCOP Domain Sequences for d1veka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gssgssggeellpdgvpeevmesaqpvaneeivaqlvsmgfsqlhcqkaaintsnagvee
amnwllshmddpdidapisgpssg

SCOP Domain Coordinates for d1veka_:

Click to download the PDB-style file with coordinates for d1veka_.
(The format of our PDB-style files is described here.)

Timeline for d1veka_: