SCOPe 2.08: Domain d1veka1: 1vek A:8-78

Lineage for d1veka1 (1vek A:8-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin isopeptidase T [116826] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116827] (2 PDB entries)
   Uniprot Q9LJT6 594-665; Q8L6Y1 651-710

8. Domain d1veka1: 1vek A:8-78 [113636]
   Other proteins in same PDB: d1veka2, d1veka3
   Structural genomics target

Details for d1veka1

PDB Entry: 1vek

PDB Description: solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna

PDB Compounds: (A:) ubiquitin-specific protease 14, putative

SCOPe Domain Sequences for d1veka1:

Sequence; same for both SEQRES and ATOM records:

>d1veka1 a.5.2.1 (A:8-78) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
geellpdgvpeevmesaqpvaneeivaqlvsmgfsqlhcqkaaintsnagveeamnwlls
hmddpdidapi

Timeline for d1veka1:

• d1veka1 first appeared in SCOP 1.71, called d1veka_
  
• d1veka1 appears in SCOPe 2.07