Lineage for d1v54c_ (1v54 C:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958717Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1958718Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 1958719Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1958732Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 1958733Species Cow (Bos taurus) [TaxId:9913] [81444] (27 PDB entries)
  8. 1958738Domain d1v54c_: 1v54 C: [100324]
    Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54c_

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (C:) cytochrome c oxidase polypeptide III

SCOPe Domain Sequences for d1v54c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d1v54c_:

Click to download the PDB-style file with coordinates for d1v54c_.
(The format of our PDB-style files is described here.)

Timeline for d1v54c_: