![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81454] (26 PDB entries) |
![]() | Domain d1v54o2: 1v54 O:1-90 [100337] Other proteins in same PDB: d1v54a_, d1v54b1, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 1v54 (more details), 1.8 Å
SCOPe Domain Sequences for d1v54o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v54o2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d1v54o2:
![]() Domains from other chains: (mouse over for more information) d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_ |