| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
| Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species) |
| Species Sulfolobus tokodaii [TaxId:111955] [117657] (1 PDB entry) Uniprot Q975C3 |
| Domain d1v4nb_: 1v4n B: [113531] structural genomics target |
PDB Entry: 1v4n (more details), 2.45 Å
SCOPe Domain Sequences for d1v4nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v4nb_ c.56.2.1 (B:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus tokodaii [TaxId: 111955]}
epkekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprhgrg
hripphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrtytf
fdgptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivwkev
fkadiigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakvkkl
lyevirrlpekpderkcsccqalktalvl
Timeline for d1v4nb_: