Lineage for d1ugpb_ (1ugp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783802Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2783803Protein Cobalt-containing nitrile hydratase [82067] (2 species)
  7. 2783806Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)
    Uniprot Q7SID3
  8. 2783807Domain d1ugpb_: 1ugp B: [107832]
    Other proteins in same PDB: d1ugpa_
    complexed with bua, co

Details for d1ugpb_

PDB Entry: 1ugp (more details), 1.63 Å

PDB Description: crystal structure of co-type nitrile hydratase complexed with n- butyric acid
PDB Compounds: (B:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d1ugpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugpb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielv

SCOPe Domain Coordinates for d1ugpb_:

Click to download the PDB-style file with coordinates for d1ugpb_.
(The format of our PDB-style files is described here.)

Timeline for d1ugpb_: