PDB entry 1ugp

View 1ugp on RCSB PDB site
Description: Crystal structure of Co-type nitrile hydratase complexed with n-butyric acid
Class: lyase
Keywords: complex, n-butyric acid, non-corrin cobalt, nitrile, hydration, lyase
Deposited on 2003-06-17, released 2004-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.182
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase alpha subunit
    Species: Pseudonocardia thermophila [TaxId:1848]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SID2 (0-202)
      • (109)
      • (111)
    Domains in SCOPe 2.07: d1ugpa_
  • Chain 'B':
    Compound: Nitrile hydratase beta subunit
    Species: Pseudonocardia thermophila [TaxId:1848]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ugpb_
  • Heterogens: CO, BUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugpA (A:)
    tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
    awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
    ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
    seeelatlvtresmigvepakav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ugpB (B:)
    mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
    aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
    qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
    tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielv