Lineage for d1uaxa_ (1uax A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 995889Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 995910Protein Class II ribonuclease H (RNase HII) [53103] (5 species)
  7. 995917Species Pyrococcus horikoshii [TaxId:53953] [110639] (2 PDB entries)
    Uniprot O59351
  8. 995918Domain d1uaxa_: 1uax A: [107764]

Details for d1uaxa_

PDB Entry: 1uax (more details), 2 Å

PDB Description: Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d1uaxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uaxa_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Pyrococcus horikoshii [TaxId: 53953]}
mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil
ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika
glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl
eeyykqygdfppivrrtwetarkieerfrkn

SCOPe Domain Coordinates for d1uaxa_:

Click to download the PDB-style file with coordinates for d1uaxa_.
(The format of our PDB-style files is described here.)

Timeline for d1uaxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uaxb_