Lineage for d1uaia_ (1uai A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781687Family b.29.1.18: Alginate lyase [101649] (3 proteins)
    members have same function and similar structures but low sequence similarity
    automatically mapped to Pfam PF08787
  6. 1781695Protein Polyguluronate lyase [110140] (1 species)
  7. 1781696Species Corynebacterium sp. ALY-1 [TaxId:101519] [110141] (1 PDB entry)
    Uniprot Q9RB42
  8. 1781697Domain d1uaia_: 1uai A: [107761]

Details for d1uaia_

PDB Entry: 1uai (more details), 1.2 Å

PDB Description: crystal structure of the alginate lyase from corynebacterium sp.
PDB Compounds: (A:) polyguluronate lyase

SCOPe Domain Sequences for d1uaia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uaia_ b.29.1.18 (A:) Polyguluronate lyase {Corynebacterium sp. ALY-1 [TaxId: 101519]}
epcdypaqqldltdwkvtlpigssgkpseieqpaldtfatapwfqvnakctgvqfraavn
gvttsgsgyprselremtdggeekaswsatsgthtmvfreafnhlpevkphlvgaqihdg
dddvtvfrlegtslyitkgddthhklvtsdyklntvfegkfvvsggkikvyyngvlqtti
shtssgnyfkagaytqancsnsspcsssnygqvslyklqvths

SCOPe Domain Coordinates for d1uaia_:

Click to download the PDB-style file with coordinates for d1uaia_.
(The format of our PDB-style files is described here.)

Timeline for d1uaia_: