Lineage for d1u8sa2 (1u8s A:88-180)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.18: ACT-like [55021] (14 families) 
regulatory domain linked to a wide range of metabolic enzymes
Family d.58.18.5: Glycine cleavage system transcriptional repressor [110980] (1 protein)
tandem repeat of two ACT-like domains; swapped domain dimerProtein putative transcriptional repressor VC2159 [110981] (1 species) Species Vibrio cholerae [TaxId:666] [110982] (1 PDB entry)
Uniprot Q9KQ45
Domain d1u8sa2: 1u8s A:88-180 [107738]
Structural genomics target
Details for d1u8sa2
PDB Entry: 1u8s (more details), 2.45 Å
PDB Description: Crystal structure of putative glycine cleavage system transcriptional repressor
PDB Compounds: (A:) glycine cleavage system transcriptional repressor, putativeSCOP Domain Sequences for d1u8sa2:
Sequence, based on SEQRES records: (download)
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]}
qthaytvevyvesddklgltekftqffaqrqigmaslsaqtiskdklhseqnqfhiaisa
rvdsgcnlmqlqeefdalctaldvqgslnfikn
Sequence, based on observed residues (ATOM records): (download)
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]}
qthaytvevyvesddklgltekftqffaqrqigmaslsaqtisnqfhiaisarvdsgcnl
mqlqeefdalctaldvqgslnfikn
SCOP Domain Coordinates for d1u8sa2:
Click to download the PDB-style file with coordinates for d1u8sa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u8sa2:
- d1u8sa2 first appeared in SCOP 1.69
- d1u8sa2 appears in SCOP 1.73
- d1u8sa2 appears in SCOPe 2.01
- d1u8sa2 appears in the current release, SCOPe 2.08
View in 3D
