Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.5: Glycine cleavage system transcriptional repressor [110980] (1 protein) tandem repeat of two ACT-like domains; swapped domain dimer |
Protein putative transcriptional repressor VC2159 [110981] (1 species) |
Species Vibrio cholerae [TaxId:666] [110982] (1 PDB entry) Uniprot Q9KQ45 |
Domain d1u8sa2: 1u8s A:88-180 [107738] Other proteins in same PDB: d1u8sa3, d1u8sb3 Structural genomics target |
PDB Entry: 1u8s (more details), 2.45 Å
SCOPe Domain Sequences for d1u8sa2:
Sequence, based on SEQRES records: (download)
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} qthaytvevyvesddklgltekftqffaqrqigmaslsaqtiskdklhseqnqfhiaisa rvdsgcnlmqlqeefdalctaldvqgslnfikn
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} qthaytvevyvesddklgltekftqffaqrqigmaslsaqtisnqfhiaisarvdsgcnl mqlqeefdalctaldvqgslnfikn
Timeline for d1u8sa2: