Class a: All alpha proteins [46456] (284 folds) |
Fold a.230: YugE-like [116921] (1 superfamily) 4-helices; bundle; right-handed twist |
Superfamily a.230.1: YugE-like [116922] (1 family) |
Family a.230.1.1: YugE-like [116923] (1 protein) |
Protein hypothetical protein YugE [116924] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [116925] (1 PDB entry) Uniprot Q5KVS1; 97% sequence identity; Geobacillus kaustophilus TaxID: 1462 |
Domain d1u84a_: 1u84 A: [113114] Structural genomics target; APC36109 complexed with edo, gol |
PDB Entry: 1u84 (more details), 1.6 Å
SCOP Domain Sequences for d1u84a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u84a_ a.230.1.1 (A:) hypothetical protein YugE {Bacillus stearothermophilus [TaxId: 1422]} gqqlnrlllewigawdpfglgkdaydveaasvlqavyetedartlaariqsiyefafdep ipfphclklarrllelkqaas
Timeline for d1u84a_: