Lineage for d1u84a_ (1u84 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737888Fold a.230: YugE-like [116921] (1 superfamily)
    4-helices; bundle; right-handed twist
  4. 2737889Superfamily a.230.1: YugE-like [116922] (1 family) (S)
    automatically mapped to Pfam PF08958
  5. 2737890Family a.230.1.1: YugE-like [116923] (1 protein)
  6. 2737891Protein hypothetical protein YugE [116924] (1 species)
  7. 2737892Species Bacillus stearothermophilus [TaxId:1422] [116925] (1 PDB entry)
    Uniprot Q5KVS1; 97% sequence identity; Geobacillus kaustophilus TaxID: 1462
  8. 2737893Domain d1u84a_: 1u84 A: [113114]
    Structural genomics target; APC36109
    complexed with edo, gol

Details for d1u84a_

PDB Entry: 1u84 (more details), 1.6 Å

PDB Description: Crystal Structure of APC36109 from Bacillus stearothermophilus
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1u84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u84a_ a.230.1.1 (A:) hypothetical protein YugE {Bacillus stearothermophilus [TaxId: 1422]}
gqqlnrlllewigawdpfglgkdaydveaasvlqavyetedartlaariqsiyefafdep
ipfphclklarrllelkqaas

SCOPe Domain Coordinates for d1u84a_:

Click to download the PDB-style file with coordinates for d1u84a_.
(The format of our PDB-style files is described here.)

Timeline for d1u84a_: