Lineage for d1u7ba1 (1u7b A:1-126)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927131Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1927132Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1927317Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 1927339Protein Proliferating cell nuclear antigen (PCNA) [55989] (7 species)
  7. 1927375Species Human (Homo sapiens) [TaxId:9606] [55991] (9 PDB entries)
    Uniprot P12004
  8. 1927376Domain d1u7ba1: 1u7b A:1-126 [113083]
    complexed with a target peptide

Details for d1u7ba1

PDB Entry: 1u7b (more details), 1.88 Å

PDB Description: Crystal structure of hPCNA bound to residues 331-350 of the flap endonuclease-1 (FEN1)
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1u7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7ba1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d1u7ba1:

Click to download the PDB-style file with coordinates for d1u7ba1.
(The format of our PDB-style files is described here.)

Timeline for d1u7ba1:

1927376
d1u7ba1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1u7ba2