Lineage for d1u2xa_ (1u2x A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618889Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1618890Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1619011Family c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase [64147] (3 proteins)
    Pfam PF04587
  6. 1619018Protein ADP-specific phosphofructokinase [110707] (1 species)
  7. 1619019Species Pyrococcus horikoshii [TaxId:53953] [110708] (1 PDB entry)
    Uniprot O59355 # PH1645
  8. 1619020Domain d1u2xa_: 1u2x A: [107622]
    complexed with so4

Details for d1u2xa_

PDB Entry: 1u2x (more details), 2 Å

PDB Description: Crystal Structure of a Hypothetical ADP-dependent Phosphofructokinase from Pyrococcus horikoshii OT3
PDB Compounds: (A:) ADP-specific phosphofructokinase

SCOPe Domain Sequences for d1u2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2xa_ c.72.1.3 (A:) ADP-specific phosphofructokinase {Pyrococcus horikoshii [TaxId: 53953]}
mipehlsiytaynanidaivklnqetiqnlinafdpdevkrrieeypreinepidfvarl
vhtlklgkpaavplvnekmnewfdktfryeeerlggqagiiantlaglkirkviaytpfl
pkrlaelfkkgvlypvvengelqfkpiqeayregdplkinrifefrkglkfklgdetiei
pnsgrfivsarfesisrietredikpflgeigkevdgaifsgyqglrtkysdgkdanyyl
rrakediiefkekdvkihvefasvqdrklrkkiitnilpfvdsvgideaeiaqilsvlgy
reladriftynrledsilggmiildelnfeilqvhttyylmyithrdnplseeelaksle
fgttlaaaraslgdirgpddykvglkvpfnerseyvklrfeeaksrlrmreykvvviptr
lvqnpvltvglgdtisagafltyleflkrh

SCOPe Domain Coordinates for d1u2xa_:

Click to download the PDB-style file with coordinates for d1u2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1u2xa_: