Class g: Small proteins [56992] (100 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
Protein Toxin B (long neurotoxin) [57349] (1 species) |
Species King cobra (Ophiophagus hannah) [TaxId:8665] [57350] (2 PDB entries) |
Domain d1txba_: 1txb A: [44455] |
PDB Entry: 1txb (more details)
SCOPe Domain Sequences for d1txba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txba_ g.7.1.1 (A:) Toxin B (long neurotoxin) {King cobra (Ophiophagus hannah) [TaxId: 8665]} tkcyvtpdatsqtcpdgqdicytktwcdgfcssrgkridlgcaatcpkvkpgvdikccst dncnpfptwkrkh
Timeline for d1txba_: