Lineage for d1twfc1 (1twf C:3-41,C:173-268)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420028Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1420151Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1420152Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1420221Protein RPB3 [64315] (2 species)
  7. 1420222Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1420223Domain d1twfc1: 1twf C:3-41,C:173-268 [112727]
    Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc2, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_
    protein/RNA complex; complexed with mn, utp, zn

Details for d1twfc1

PDB Entry: 1twf (more details), 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d1twfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twfc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

SCOPe Domain Coordinates for d1twfc1:

Click to download the PDB-style file with coordinates for d1twfc1.
(The format of our PDB-style files is described here.)

Timeline for d1twfc1: