SCOPe 2.03: Domain d1twfi2: 1twf I:50-121

Lineage for d1twfi2 (1twf I:50-121)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
   Uniprot P27999; part of multichain biological unit

8. Domain d1twfi2: 1twf I:50-121 [112734]
   Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfj_, d1twfk_, d1twfl_
   protein/RNA complex; complexed with mn, utp, zn

Details for d1twfi2

PDB Entry: 1twf, 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution

PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOPe Domain Sequences for d1twfi2:

Sequence; same for both SEQRES and ATOM records:

>d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqf

Timeline for d1twfi2:

• d1twfi2 first appeared in SCOP 1.71
  
• d1twfi2 appears in SCOPe 2.02
  
• d1twfi2 appears in SCOPe 2.04
  
• d1twfi2 appears in the current release, SCOPe 2.08