Lineage for d1tvfa2 (1tvf A:15-315)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690812Protein Pencillin binding protein 4 (PbpD), N-terminal domain [111287] (1 species)
  7. 1690813Species Staphylococcus aureus [TaxId:1280] [111288] (3 PDB entries)
    Uniprot Q53613 21-383
  8. 1690814Domain d1tvfa2: 1tvf A:15-315 [107359]
    Other proteins in same PDB: d1tvfa1, d1tvfb1
    Structural genomics target
    complexed with so4, unl

Details for d1tvfa2

PDB Entry: 1tvf (more details), 2 Å

PDB Description: crystal structure of penicillin-binding protein 4 (pbp4) from staphylococcus aureus
PDB Compounds: (A:) penicillin binding protein 4

SCOPe Domain Sequences for d1tvfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvfa2 e.3.1.1 (A:15-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
gphtssyaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpa
smtklmtmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqi
tvsnssnaaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptk
ykdqertvttardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpg
tdglktgssdtanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdq
y

SCOPe Domain Coordinates for d1tvfa2:

Click to download the PDB-style file with coordinates for d1tvfa2.
(The format of our PDB-style files is described here.)

Timeline for d1tvfa2:

1690814
d1tvfa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1tvfa1