Lineage for d1tv0a_ (1tv0 A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748687Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 748688Superfamily g.9.1: Defensin-like [57392] (2 families) (S)
  5. 748689Family g.9.1.1: Defensin [57393] (10 proteins)
  6. 748757Protein Defensin-related cryptdin 4 [118245] (1 species)
  7. 748758Species Mouse (Mus musculus) [TaxId:10090] [118246] (2 PDB entries)
  8. 748759Domain d1tv0a_: 1tv0 A: [112671]

Details for d1tv0a_

PDB Entry: 1tv0 (more details)

PDB Description: solution structure of cryptdin-4, the most potent alpha-defensin from mouse paneth cells
PDB Compounds: (A:) Cryptdin-4

SCOP Domain Sequences for d1tv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tv0a_ g.9.1.1 (A:) Defensin-related cryptdin 4 {Mouse (Mus musculus) [TaxId: 10090]}
gllcycrkghckrgervrgtcgirflyccprr

SCOP Domain Coordinates for d1tv0a_:

Click to download the PDB-style file with coordinates for d1tv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1tv0a_: