PDB entry 1tv0

View 1tv0 on RCSB PDB site
Description: Solution structure of cryptdin-4, the most potent alpha-defensin from mouse Paneth cells
Class: antimicrobial protein
Keywords: beta sheet, beta hairpin
Deposited on 2004-06-25, released 2005-01-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-04, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cryptdin-4
    Species: MUS MUSCULUS
    Gene: Defcr4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tv0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tv0A (A:)
    gllcycrkghckrgervrgtcgirflyccprr