Lineage for d1toza1 (1toz A:411-452)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. Protein Neurogenic locus notch homolog protein 1, Notch1 [118243] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [118244] (1 PDB entry)
    Uniprot P46531 411-526
  8. 2636277Domain d1toza1: 1toz A:411-452 [112605]

Details for d1toza1

PDB Entry: 1toz (more details)

PDB Description: nmr structure of the human notch-1 ligand binding region
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d1toza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1toza1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}
qdvdecslganpcehagkcintlgsfecqclqgytgprceid

SCOPe Domain Coordinates for d1toza1:

Click to download the PDB-style file with coordinates for d1toza1.
(The format of our PDB-style files is described here.)

Timeline for d1toza1: