Lineage for d1tjta2 (1tjt A:156-265)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.40: CH domain-like [47575] (3 superfamilies)
core: 4 helices: bundleSuperfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) 
Family a.40.1.0: automated matches [227151] (1 protein)
not a true familyProtein automated matches [226856] (4 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) 
Domain d1tjta2: 1tjt A:156-265 [202922]
automated match to d1sh5a2
Details for d1tjta2
PDB Entry: 1tjt (more details), 2.19 Å
PDB Description: x-ray structure of the human alpha-actinin isoform 3 at 2.2a resolution
PDB Compounds: (A:) Alpha-actinin 3SCOPe Domain Sequences for d1tjta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjta2 a.40.1.0 (A:156-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetsakeglllwcqrktapyrnvnvqnfhtswkdglalcalihrhrpdlidyaklrkddp
ignlntafevaekyldipkmldaedivntpkpdekaimtyvscfyhafag
SCOPe Domain Coordinates for d1tjta2:
Click to download the PDB-style file with coordinates for d1tjta2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tjta2:
- d1tjta2 first appeared in SCOPe 2.03
- d1tjta2 appears in SCOPe 2.06
- d1tjta2 appears in the current release, SCOPe 2.08
View in 3D
