Lineage for d1tfmb1 (1tfm B:1-133)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1543501Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 1543514Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
    different sequence variants
    Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity
  8. 1543531Domain d1tfmb1: 1tfm B:1-133 [106856]
    Other proteins in same PDB: d1tfma_
    complexed with gal, nag, p6c

Details for d1tfmb1

PDB Entry: 1tfm (more details), 2.8 Å

PDB Description: crystal structure of a ribosome inactivating protein in its naturally inhibited form
PDB Compounds: (B:) Himalayan mistletoe ribosome-inactivating protein

SCOPe Domain Sequences for d1tfmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfmb1 b.42.2.1 (B:1-133) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
dytlgqgwlagnd

SCOPe Domain Coordinates for d1tfmb1:

Click to download the PDB-style file with coordinates for d1tfmb1.
(The format of our PDB-style files is described here.)

Timeline for d1tfmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfmb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tfma_