Lineage for d1t7sa_ (1t7s A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
3 helices; bundle, closed, left-handed twist; up-and-down
Superfamily a.7.7: BAG domain [63491] (1 family) 
Family a.7.7.1: BAG domain [63492] (4 proteins)
Pfam PF02179
this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domainProtein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species) 
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [109744] (1 PDB entry)
Uniprot O44739 74-210
Domain d1t7sa_: 1t7s A: [106636]
Structural genomics target
in the crystal, there is a tetramer made two helix-swapped dimers with an unusual beta-sheet interface
Details for d1t7sa_
PDB Entry: 1t7s (more details), 2.8 Å
PDB Description: Structural Genomics of Caenorhabditis elegans: Structure of BAG-1 protein
PDB Compounds: (A:) BAG-1 cochaperoneSCOP Domain Sequences for d1t7sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dkiivmggknalvddagfkmlmqyekhnlsnlqkaydlnlrdvadlergflekpkqvemg
kklekkvkyfneeaerhletldgmniitettpenqakrnrekrktlvngiqtllnqndal
lrrlqeyqs
SCOP Domain Coordinates for d1t7sa_:
Click to download the PDB-style file with coordinates for d1t7sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t7sa_:
- d1t7sa_ first appeared in SCOP 1.69
- d1t7sa_ appears in SCOP 1.73
- d1t7sa_ appears in SCOPe 2.01
- d1t7sa_ appears in the current release, SCOPe 2.08
View in 3D
