Lineage for d1t6la2 (1t6l A:136-270)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.131: DNA clamp [55978] (1 superfamily)
contains two helices and two beta sheets
duplication: fold has internal pseudo two-fold symmetrySuperfamily d.131.1: DNA clamp [55979] (3 families) 
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
duplication: consists of two domains of this fold
Protein UL44 [111176] (2 species) Species Human cytomegalovirus, HHV-5 [TaxId:10359] [111177] (2 PDB entries)
Uniprot P16790 1-290
Domain d1t6la2: 1t6l A:136-270 [106575]
Details for d1t6la2
PDB Entry: 1t6l (more details), 1.85 Å
PDB Description: Crystal Structure of the Human Cytomegalovirus DNA Polymerase Subunit, UL44
PDB Compounds: (A:) DNA polymerase processivity factorSCOPe Domain Sequences for d1t6la2:
Sequence, based on SEQRES records: (download)
>d1t6la2 d.131.1.2 (A:136-270) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]}
vresensavhvdldfgvvadllkwigphtrvkrnvkkapcptgtvqilvhagppaikfil
tngseleftsnnrvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyva
srnglfavenfltee
Sequence, based on observed residues (ATOM records): (download)
>d1t6la2 d.131.1.2 (A:136-270) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]}
vresensavhvdldfgvvadllkwigpcptgtvqilvhagppaikfiltngseleftsnn
rvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyvasrnglfavenfl
tee
SCOPe Domain Coordinates for d1t6la2:
Click to download the PDB-style file with coordinates for d1t6la2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t6la2:
- d1t6la2 first appeared in SCOP 1.69
- d1t6la2 appears in SCOPe 2.06
- d1t6la2 appears in the current release, SCOPe 2.08
View in 3D
