![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
![]() | Protein UL44 [111176] (2 species) |
![]() | Species Human cytomegalovirus, HHV-5 [TaxId:10359] [111177] (2 PDB entries) Uniprot P16790 1-290 |
![]() | Domain d1t6la2: 1t6l A:136-270 [106575] |
PDB Entry: 1t6l (more details), 1.85 Å
SCOPe Domain Sequences for d1t6la2:
Sequence, based on SEQRES records: (download)
>d1t6la2 d.131.1.2 (A:136-270) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]} vresensavhvdldfgvvadllkwigphtrvkrnvkkapcptgtvqilvhagppaikfil tngseleftsnnrvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyva srnglfavenfltee
>d1t6la2 d.131.1.2 (A:136-270) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]} vresensavhvdldfgvvadllkwigpcptgtvqilvhagppaikfiltngseleftsnn rvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyvasrnglfavenfl tee
Timeline for d1t6la2: