SCOPe 2.08: Domain d1t6la1: 1t6l A:10-135

Lineage for d1t6la1 (1t6l A:10-135)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein UL44 [111176] (2 species)

7. Species Human cytomegalovirus, HHV-5 [TaxId:10359] [111177] (2 PDB entries)
   Uniprot P16790 1-290

8. Domain d1t6la1: 1t6l A:10-135 [106574]

Details for d1t6la1

PDB Entry: 1t6l, 1.85 Å

PDB Description: Crystal Structure of the Human Cytomegalovirus DNA Polymerase Subunit, UL44

PDB Compounds: (A:) DNA polymerase processivity factor

SCOPe Domain Sequences for d1t6la1:

Sequence; same for both SEQRES and ATOM records:

>d1t6la1 d.131.1.2 (A:10-135) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]}
pptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskitfnsscly
itdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfnmefssac
vhgqdi

Timeline for d1t6la1:

• d1t6la1 first appeared in SCOP 1.69
  
• d1t6la1 appears in SCOPe 2.07