| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
| Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species) |
| Species Salmonella typhimurium [TaxId:90371] [111182] (1 PDB entry) Uniprot P74881 |
| Domain d1t3ta7: 1t3t A:817-1033 [106387] Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5 complexed with adp, mg, so4 |
PDB Entry: 1t3t (more details), 1.9 Å
SCOPe Domain Sequences for d1t3ta7:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ta7 d.139.1.1 (A:817-1033) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 90371]}
pqlstednalllidlgkghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaa
rkllawhdrsdggllvtlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedr
daveallaqygladcvhylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlr
dnpqcadqeheakandtdpglnvklsfdinediaapy
Timeline for d1t3ta7: