Lineage for d1sx6a_ (1sx6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350805Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2350806Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2350807Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 2350808Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 2350811Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
    Uniprot Q9NZD2
  8. 2350821Domain d1sx6a_: 1sx6 A: [106078]
    complexed with lat, oct, ola, sph

Details for d1sx6a_

PDB Entry: 1sx6 (more details), 1.95 Å

PDB Description: crystal structure of human glycolipid transfer protein in lactosylceramide-bound form
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d1sx6a_:

Sequence, based on SEQRES records: (download)

>d1sx6a_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlf
lvnytatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records): (download)

>d1sx6a_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskqnvteeeclekirlfl
vnytatidviyemytqmnaelnykv

SCOPe Domain Coordinates for d1sx6a_:

Click to download the PDB-style file with coordinates for d1sx6a_.
(The format of our PDB-style files is described here.)

Timeline for d1sx6a_: