Lineage for d1sota2 (1sot A:43-254)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064172Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2064311Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 2064312Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 2064325Domain d1sota2: 1sot A:43-254 [105853]
    Other proteins in same PDB: d1sota1, d1sota3, d1sotb1, d1sotb3, d1sotc1, d1sotc3

Details for d1sota2

PDB Entry: 1sot (more details), 2.3 Å

PDB Description: Crystal Structure of the DegS stress sensor
PDB Compounds: (A:) Protease degS

SCOPe Domain Sequences for d1sota2:

Sequence, based on SEQRES records: (download)

>d1sota2 b.47.1.1 (A:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk
sndgetpegigfaipfqlatkimdklirdgrv

Sequence, based on observed residues (ATOM records): (download)

>d1sota2 b.47.1.1 (A:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfde
gigfaipfqlatkimdklirdgrv

SCOPe Domain Coordinates for d1sota2:

Click to download the PDB-style file with coordinates for d1sota2.
(The format of our PDB-style files is described here.)

Timeline for d1sota2: