| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
| Protein DJ-1 [89603] (1 species) RNA-binding protein regulatory subunit |
| Species Human (Homo sapiens) [TaxId:9606] [89604] (40 PDB entries) Uniprot Q99497 |
| Domain d1soaa_: 1soa A: [105843] |
PDB Entry: 1soa (more details), 1.2 Å
SCOPe Domain Sequences for d1soaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1soaa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk
Timeline for d1soaa_: