Lineage for d1soaa_ (1soa A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840330Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1840499Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 1840500Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 1840501Species Human (Homo sapiens) [TaxId:9606] [89604] (40 PDB entries)
    Uniprot Q99497
  8. 1840511Domain d1soaa_: 1soa A: [105843]

Details for d1soaa_

PDB Entry: 1soa (more details), 1.2 Å

PDB Description: human dj-1 with sulfinic acid
PDB Compounds: (A:) RNA-binding protein regulatory subunit; oncogene DJ1

SCOPe Domain Sequences for d1soaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soaa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOPe Domain Coordinates for d1soaa_:

Click to download the PDB-style file with coordinates for d1soaa_.
(The format of our PDB-style files is described here.)

Timeline for d1soaa_: