Lineage for d1siza_ (1siz A:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) 
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
contains only one 4Fe-4S cluster
Protein Fe3S4-ferredoxin PF1909 [110946] (1 species) Species Pyrococcus furiosus [TaxId:2261] [110947] (4 PDB entries)
Uniprot P29603
Domain d1siza_: 1siz A: [105593]
complexed with 3co, f3s
Details for d1siza_
PDB Entry: 1siz (more details), 2.25 Å
PDB Description: Crystal structure of the [Fe3S4]-ferredoxin from the hyperthermophilic archaeon Pyrococcus furiosus
PDB Compounds: (A:) ferredoxinSCOPe Domain Sequences for d1siza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1siza_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea
SCOPe Domain Coordinates for d1siza_:
Click to download the PDB-style file with coordinates for d1siza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1siza_:
- d1siza_ first appeared in SCOP 1.69
- d1siza_ appears in SCOPe 2.01
- d1siza_ appears in SCOPe 2.03
- d1siza_ appears in the current release, SCOPe 2.08
View in 3D
