![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries) Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167 |
![]() | Domain d1sdva_: 1sdv A: [105446] complexed with cl, mk1; mutant |
PDB Entry: 1sdv (more details), 1.4 Å
SCOPe Domain Sequences for d1sdva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sdva_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
Timeline for d1sdva_: