Lineage for d1sc0a_ (1sc0 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) 
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) 
Protein Hypothetical protein HI1161 [89905] (1 species) Species Haemophilus influenzae [TaxId:727] [89906] (3 PDB entries) 
Domain d1sc0a_: 1sc0 A: [98796]
structural genomics; NESG target IR63
Details for d1sc0a_
PDB Entry: 1sc0 (more details)
PDB Description: X-ray Structure of YB61_HAEIN Northeast Structural Genomics Consortium Target IR63
PDB Compounds: (A:) Hypothetical protein HI1161SCOPe Domain Sequences for d1sc0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
enklccvsrltlsvinl
SCOPe Domain Coordinates for d1sc0a_:
Click to download the PDB-style file with coordinates for d1sc0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sc0a_:
- d1sc0a_ first appeared in SCOP 1.67
- d1sc0a_ appears in SCOPe 2.07
View in 3D
