| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
| Family c.52.1.23: Restriction endonuclease MspI [110624] (1 protein) automatically mapped to Pfam PF09208 |
| Protein Restriction endonuclease MspI [110625] (1 species) |
| Species Moraxella sp. [TaxId:479] [110626] (2 PDB entries) Uniprot P11405 |
| Domain d1sa3a_: 1sa3 A: [105400] protein/DNA complex; complexed with na |
PDB Entry: 1sa3 (more details), 1.95 Å
SCOPe Domain Sequences for d1sa3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sa3a_ c.52.1.23 (A:) Restriction endonuclease MspI {Moraxella sp. [TaxId: 479]}
mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
fgtglnwtyasgskakkmqfkg
Timeline for d1sa3a_: