![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
![]() | Family c.52.1.23: Restriction endonuclease MspI [110624] (1 protein) automatically mapped to Pfam PF09208 |
![]() | Protein Restriction endonuclease MspI [110625] (1 species) |
![]() | Species Moraxella sp. [TaxId:479] [110626] (2 PDB entries) Uniprot P11405 |
![]() | Domain d1sa3b_: 1sa3 B: [105401] protein/DNA complex; complexed with na |
PDB Entry: 1sa3 (more details), 1.95 Å
SCOPe Domain Sequences for d1sa3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sa3b_ c.52.1.23 (B:) Restriction endonuclease MspI {Moraxella sp. [TaxId: 479]} mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg fgtglnwtyasgskakkmqfkg
Timeline for d1sa3b_: