Lineage for d1s5qb_ (1s5q B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737558Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 1737559Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 1737560Family a.59.1.1: PAH2 domain [47763] (3 proteins)
  6. 1737561Protein Sin3A [47766] (1 species)
  7. 1737562Species Mouse (Mus musculus) [TaxId:10090] [47767] (5 PDB entries)
    Uniprot Q96ST3 295-383
  8. 1737564Domain d1s5qb_: 1s5q B: [105279]
    Other proteins in same PDB: d1s5qa_

Details for d1s5qb_

PDB Entry: 1s5q (more details)

PDB Description: solution structure of mad1 sid-msin3a pah2 complex
PDB Compounds: (B:) Sin3a protein

SCOPe Domain Sequences for d1s5qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5qb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]}
slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt
eqevyaqvarlfknqedllsefgqflpda

SCOPe Domain Coordinates for d1s5qb_:

Click to download the PDB-style file with coordinates for d1s5qb_.
(The format of our PDB-style files is described here.)

Timeline for d1s5qb_:

1737564
d1s5qb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1s5qa_