Lineage for d1s2oa1 (1s2o A:1-244)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1628893Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 1628932Protein Sucrose-phosphatase Slr0953 [142163] (1 species)
  7. 1628933Species Synechocystis sp. PCC 6803 [TaxId:1148] [142164] (9 PDB entries)
    Uniprot P74325 1-244
  8. 1628934Domain d1s2oa1: 1s2o A:1-244 [118846]
    complexed with mg

Details for d1s2oa1

PDB Entry: 1s2o (more details), 1.4 Å

PDB Description: X-Ray structure of the sucrose-phosphatase (SPP) from Synechocystis sp. PCC6803 at 1.40 A resolution
PDB Compounds: (A:) Sucrose-Phosphatase

SCOPe Domain Sequences for d1s2oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls

SCOPe Domain Coordinates for d1s2oa1:

Click to download the PDB-style file with coordinates for d1s2oa1.
(The format of our PDB-style files is described here.)

Timeline for d1s2oa1: